ISLR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081629
Article Name: ISLR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081629
Supplier Catalog Number: orb2081629
Alternative Catalog Number: BYT-ORB2081629-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISLR
Conjugation: Biotin
Alternative Names: Meflin, HsT17563
ISLR Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 47 kDa
NCBI: 958934
UniProt: O14498
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KGCYTVDNEVQPSGPEDNVVIIYLSRAGNPEAAVAEGVPGQLPPGLLLLG