HOXD13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081653
Article Name: HOXD13 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081653
Supplier Catalog Number: orb2081653
Alternative Catalog Number: BYT-ORB2081653-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-HOXD13 antibody is: synthetic peptide directed towards the N-terminal region of Human HXD13
Conjugation: Biotin
Alternative Names: BDE, SPD, BDSD, SPD1, HOX4I
HOXD13 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 37 kDa
NCBI: 000514
UniProt: P35453
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ASGFAYPGTSERTGSSSSSSSSAVVAARPEAPPAKECPAPTPAAAAAAPP