GCNT2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2081715
Article Name: GCNT2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081715
Supplier Catalog Number: orb2081715
Alternative Catalog Number: BYT-ORB2081715-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNT2C
Conjugation: FITC
Alternative Names: II, CCAT, IGNT, ULG3, GCNT5, GCNT2C, NACGT1, NAGCT1, CTRCT13, bA421M1.1, bA360O19.2
GCNT2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 663630
UniProt: Q8NFS9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACN