FUT4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2081723
Article Name: FUT4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081723
Supplier Catalog Number: orb2081723
Alternative Catalog Number: BYT-ORB2081723-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FUT4
Conjugation: HRP
Alternative Names: LeX, CD15, ELFT, FCT3A, FUTIV, SSEA-1, FUC-TIV
FUT4 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 002024
UniProt: P22083
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: WASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASY