FUT4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2081724
Article Name: FUT4 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081724
Supplier Catalog Number: orb2081724
Alternative Catalog Number: BYT-ORB2081724-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FUT4
Conjugation: FITC
Alternative Names: LeX, CD15, ELFT, FCT3A, FUTIV, SSEA-1, FUC-TIV
FUT4 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 002024
UniProt: P22083
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: WASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASY