ELF5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2081754
Article Name: ELF5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081754
Supplier Catalog Number: orb2081754
Alternative Catalog Number: BYT-ORB2081754-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELF5
Conjugation: FITC
Alternative Names: ESE2
ELF5 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 938195
UniProt: Q9UKW6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: WEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILER