DCTN1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081800
Article Name: DCTN1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081800
Supplier Catalog Number: orb2081800
Alternative Catalog Number: BYT-ORB2081800-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DCTN1
Conjugation: Biotin
Alternative Names: P135, DP-150, DAP-150
DCTN1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 140kDa
UniProt: Q14203
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TAMQEGEYDAERPPSKPPPVELRAAALRAEITDAEGLGLKLEDRETVIKE