CLCN5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2081840
Article Name: CLCN5 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081840
Supplier Catalog Number: orb2081840
Alternative Catalog Number: BYT-ORB2081840-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CLCN5
Conjugation: HRP
Alternative Names: XRN, CLC5, XLRH, CLCK2, ClC-5, DENTS, NPHL1, NPHL2, hCIC-K2
CLCN5 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 82kDa
UniProt: P51795
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTWALIHSV