BNC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2081881
Article Name: BNC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2081881
Supplier Catalog Number: orb2081881
Alternative Catalog Number: BYT-ORB2081881-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human BNC1
Conjugation: Biotin
Alternative Names: BNC, BSN1, POF16, HsT19447
BNC1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 109kDa
NCBI: 001708
UniProt: Q01954
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ASSENYKCPGFTVTSPDCRPPPSYPGSGEDSKGQPAFPNIGQNGVLFPNL