UIMC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082166
Article Name: UIMC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082166
Supplier Catalog Number: orb2082166
Alternative Catalog Number: BYT-ORB2082166-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human UIMC1
Conjugation: Biotin
Alternative Names: RAP80, X2HRIP110
UIMC1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 79kDa
UniProt: Q96RL1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKL