LUC7L2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2082170
Article Name: LUC7L2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082170
Supplier Catalog Number: orb2082170
Alternative Catalog Number: BYT-ORB2082170-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LC7L2
Conjugation: HRP
Alternative Names: CGI-59, CGI-74, LUC7B2
LUC7L2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 057103
UniProt: Q9Y383
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPRDRDRKDKKRSYE