MED15 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2082179
Article Name: MED15 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082179
Supplier Catalog Number: orb2082179
Alternative Catalog Number: BYT-ORB2082179-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MED15
Conjugation: HRP
Alternative Names: TIG1, CAG7A, CTG7A, PCQAP, TIG-1, TNRC7, ARC105
MED15 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 86kDa
UniProt: Q96RN5
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPV