NELFCD Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2082183
Article Name: NELFCD Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082183
Supplier Catalog Number: orb2082183
Alternative Catalog Number: BYT-ORB2082183-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human NELFD
Conjugation: FITC
Alternative Names: TH1, TH1L, NELF-C, NELF-D, HSPC130
NELFCD Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 22kDa
UniProt: Q8IXH7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAGAVPGAIMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHK