ZBTB7B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082193
Article Name: ZBTB7B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082193
Supplier Catalog Number: orb2082193
Alternative Catalog Number: BYT-ORB2082193-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZBT7B
Conjugation: Biotin
Alternative Names: CKROX, THPOK, ZFP67, ZBTB15, ZFP-67, c-KROX, hcKROX, ZNF857B
ZBTB7B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 006711422
UniProt: O15156
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GDRPYECHLCHKAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPS