MED17 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082418
Article Name: MED17 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082418
Supplier Catalog Number: orb2082418
Alternative Catalog Number: BYT-ORB2082418-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MED17
Conjugation: Biotin
Alternative Names: SRB4, CRSP6, CRSP77, DRIP80, TRAP80
MED17 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 004259
UniProt: Q9NVC6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQNVLL