NOP14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2082436
| Article Name: |
NOP14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2082436 |
| Supplier Catalog Number: |
orb2082436 |
| Alternative Catalog Number: |
BYT-ORB2082436-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NOP14 |
| Conjugation: |
Biotin |
| Alternative Names: |
UTP2, NOL14, C4orf9, RES425, RES4-25 |
| NOP14 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
94kDa |
| NCBI: |
003694 |
| UniProt: |
P78316 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: EIQTLLSHKTPKSENRDKKEKPKPDAYDMMVRELGFEMKAQPSNRMKTEA |
