TNFSF11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082439
Article Name: TNFSF11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082439
Supplier Catalog Number: orb2082439
Alternative Catalog Number: BYT-ORB2082439-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TNF11
Conjugation: Biotin
Alternative Names: ODF, OPGL, sOdf, CD254, OPTB2, RANKL, TNLG6B, TRANCE, hRANKL2
TNFSF11 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
UniProt: O14788
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYS