NKX2-1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082487
Article Name: NKX2-1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082487
Supplier Catalog Number: orb2082487
Alternative Catalog Number: BYT-ORB2082487-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-NKX2-1 antibody is: synthetic peptide directed towards the N-terminal region of Human NKX21
Conjugation: Biotin
Alternative Names: BCH, BHC, NK-2, TEBP, TTF1, NKX2A, NMTC1, T/EBP, TITF1, TTF-1, NKX2.1
NKX2-1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40 kDa
NCBI: 003308
UniProt: P43699
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AVTAAYHMTAAGVPQLSHSAVGGYCNGNLGNMSELPPYQDTMRNSASGPG