ETFDH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082784
Article Name: ETFDH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082784
Supplier Catalog Number: orb2082784
Alternative Catalog Number: BYT-ORB2082784-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ETFD
Conjugation: Biotin
Alternative Names: MADD, ETFQO
ETFDH Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 004444
UniProt: Q16134
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RITTHYTIYPRDKDKRWEGVNMERFAEEADVVIVGAGPAGLSAAVRLKQL