AMHR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2082928
Article Name: AMHR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2082928
Supplier Catalog Number: orb2082928
Alternative Catalog Number: BYT-ORB2082928-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMHR2
Conjugation: Biotin
Alternative Names: AMHR, MRII, MISR2, MISRII
AMHR2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 065434
UniProt: Q16671
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VRGEPVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKL