SNX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083075
Article Name: SNX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083075
Supplier Catalog Number: orb2083075
Alternative Catalog Number: BYT-ORB2083075-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SNX1
Conjugation: Biotin
Alternative Names: VPS5, HsT17379
SNX1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 57kDa
UniProt: Q13596
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ITTSLLPINNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLA