PTK2B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083189
Article Name: PTK2B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083189
Supplier Catalog Number: orb2083189
Alternative Catalog Number: BYT-ORB2083189-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human FAK2
Conjugation: Biotin
Alternative Names: PKB, PTK, CAKB, FAK2, PYK2, CADTK, FADK2, RAFTK
PTK2B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 106kDa
UniProt: Q14289
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQEEDFIQPSSREE