PRODH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083201
Article Name: PRODH Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083201
Supplier Catalog Number: orb2083201
Alternative Catalog Number: BYT-ORB2083201-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PROD
Conjugation: Biotin
Alternative Names: POX, PIG6, HSPOX2, PRODH1, PRODH2, TP53I6
PRODH Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 057419
UniProt: O43272
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EAEHKEMESCTSAAERDGSGTNKRDKQYQAHRAFGDRRNGVISARTYFYA