NFYC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083255
Article Name: NFYC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083255
Supplier Catalog Number: orb2083255
Alternative Catalog Number: BYT-ORB2083255-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human NFYC
Conjugation: Biotin
Alternative Names: HSM, CBFC, HAP5, CBF-C, NF-YC, H1TF2A
NFYC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 50kDa
UniProt: Q13952
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQGQRNASQGKPRR