MMP14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083282
Article Name: MMP14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083282
Supplier Catalog Number: orb2083282
Alternative Catalog Number: BYT-ORB2083282-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MMP14
Conjugation: Biotin
Alternative Names: MMP-14, MMP-X1, MT-MMP, MT1MMP, MTMMP1, WNCHRS, MT1-MMP, MT-MMP 1
MMP14 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 64 kDa
NCBI: 004986
UniProt: P50281
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMD