ITIH4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2083324
| Article Name: |
ITIH4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2083324 |
| Supplier Catalog Number: |
orb2083324 |
| Alternative Catalog Number: |
BYT-ORB2083324-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITIH4 |
| Conjugation: |
Biotin |
| Alternative Names: |
H4P, IHRP, GP120, PK120, ITIHL1, PK-120, ITI-HC4 |
| ITIH4 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
102kDa |
| NCBI: |
002209 |
| UniProt: |
Q14624 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: QEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVE |
