GIGYF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083357
Article Name: GIGYF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083357
Supplier Catalog Number: orb2083357
Alternative Catalog Number: BYT-ORB2083357-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PERQ2
Conjugation: Biotin
Alternative Names: GYF2, PERQ2, PERQ3, PARK11, TNRC15
GIGYF2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 142kDa
NCBI: 056390
UniProt: Q6Y7W6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAGSRRDGERWRPHSPDGPRSAGWREHMERRRRFEFDFRDRDDERGYRRV