SF3A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083423
Article Name: SF3A2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083423
Supplier Catalog Number: orb2083423
Alternative Catalog Number: BYT-ORB2083423-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SF3A2
Conjugation: Biotin
Alternative Names: PRP11, SAP62, PRPF11, SF3a66
SF3A2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 009096
UniProt: Q15428
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECK