FHIT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083462
Article Name: FHIT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083462
Supplier Catalog Number: orb2083462
Alternative Catalog Number: BYT-ORB2083462-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FHIT
Conjugation: Biotin
Alternative Names: FRA3B, AP3Aase
FHIT Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 005265010
UniProt: P49789
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAAL