EXOC7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083477
Article Name: EXOC7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083477
Supplier Catalog Number: orb2083477
Alternative Catalog Number: BYT-ORB2083477-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EXOC7
Conjugation: Biotin
Alternative Names: BLOM4, EX070, EXO70, EXOC1, 2-5-3p, Exo70p, NEDSEBA, YJL085W
EXOC7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 056034
UniProt: Q9UPT5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GLITSMETIGAKALEDFADNIKNDPDKEYNMPKDGTVHELTSNAILFLQQ