ELF5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2083486
Article Name: ELF5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2083486
Supplier Catalog Number: orb2083486
Alternative Catalog Number: BYT-ORB2083486-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELF5
Conjugation: Biotin
Alternative Names: ESE2
ELF5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 938195
UniProt: Q9UKW6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNA