PDE10A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084137
Article Name: PDE10A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084137
Supplier Catalog Number: orb2084137
Alternative Catalog Number: BYT-ORB2084137-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PDE10A
Conjugation: Biotin
Alternative Names: ADSD2, IOLOD, HSPDE10A, PDE10A19, LINC00473
PDE10A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 85kDa
UniProt: Q9Y233
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SLHPQVLDEFVSESVSAETVEKWLKRKNNKSEDESAPKEVSRYQDTNMQG