CRABP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084179
Article Name: CRABP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084179
Supplier Catalog Number: orb2084179
Alternative Catalog Number: BYT-ORB2084179-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CRABP2
Conjugation: Biotin
Alternative Names: RBP6, CRABP-II
CRABP2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 001869
UniProt: P29373
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVV