TXN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084215
Article Name: TXN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084215
Supplier Catalog Number: orb2084215
Alternative Catalog Number: BYT-ORB2084215-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TXN
Conjugation: Biotin
Alternative Names: TRX, TRDX, TRX1, Trx80
TXN Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 003320
UniProt: P10599
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT