HEBP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084275
Article Name: HEBP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084275
Supplier Catalog Number: orb2084275
Alternative Catalog Number: BYT-ORB2084275-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HEBP1
Conjugation: Biotin
Alternative Names: HBP, HEBP
HEBP1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 057071
UniProt: Q9NRV9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWL