UNK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2084290
| Article Name: |
UNK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2084290 |
| Supplier Catalog Number: |
orb2084290 |
| Alternative Catalog Number: |
BYT-ORB2084290-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the Middle region of Mouse UNK |
| Conjugation: |
Biotin |
| Alternative Names: |
Unkh, Zc3h5, Zc3hdc5, mKIAA1753, B230379M23Rik |
| UNK Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
87 kDa |
| UniProt: |
Q8BL48 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: YVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNV |
