RAD51 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084347
Article Name: RAD51 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084347
Supplier Catalog Number: orb2084347
Alternative Catalog Number: BYT-ORB2084347-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RAD51
Conjugation: Biotin
Alternative Names: RECA, BRCC5, FANCR, MRMV2, HRAD51, RAD51A, HsRad51, HsT16930
RAD51 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
UniProt: Q06609
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIK