RAB14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084362
Article Name: RAB14 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084362
Supplier Catalog Number: orb2084362
Alternative Catalog Number: BYT-ORB2084362-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAB14
Conjugation: Biotin
Alternative Names: FBP, RAB-14
RAB14 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 057406
UniProt: P61106
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAK