SCNN1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084419
Article Name: SCNN1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084419
Supplier Catalog Number: orb2084419
Alternative Catalog Number: BYT-ORB2084419-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human SCNN1B
Conjugation: Biotin
Alternative Names: BESC1, ENaCb, SCNEB, LIDLS1, ENaCbeta
SCNN1B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 000327
UniProt: P51168
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQ