ZCCHC18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084443
Article Name: ZCCHC18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084443
Supplier Catalog Number: orb2084443
Alternative Catalog Number: BYT-ORB2084443-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZCCHC18
Conjugation: Biotin
Alternative Names: SIZN2, PNMA7B
ZCCHC18 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 001137450
UniProt: P0CG32
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SGGSGYKNDGPGNIRRARKRKYTTRCSYCGEEGHSKETCDNESNKAQVFE