MROH1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084527
Article Name: MROH1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084527
Supplier Catalog Number: orb2084527
Alternative Catalog Number: BYT-ORB2084527-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MROH1
Conjugation: Biotin
Alternative Names: HEATR7A
MROH1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 46kDa
UniProt: Q8NDA8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RAAVLRAMERVLSSRASELDKDTASTIILLASSEMTKTKDLVWDWQQAAS