RTL8A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084557
Article Name: RTL8A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084557
Supplier Catalog Number: orb2084557
Alternative Catalog Number: BYT-ORB2084557-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human FAM127B
Conjugation: Biotin
Alternative Names: CXX1b, MAR8A, SIRH6, FAM127B
RTL8A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 12kDa
UniProt: Q9BWD3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMF