CD300LF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2084587
| Article Name: |
CD300LF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2084587 |
| Supplier Catalog Number: |
orb2084587 |
| Alternative Catalog Number: |
BYT-ORB2084587-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of Human CD300LF |
| Conjugation: |
Biotin |
| Alternative Names: |
CLM1, NKIR, CLM-1, IREM1, LMIR3, CD300f, IREM-1, IgSF13 |
| CD300LF Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
26kDa |
| UniProt: |
Q8TDQ1 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: IWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYW |
