SHISA7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084662
Article Name: SHISA7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084662
Supplier Catalog Number: orb2084662
Alternative Catalog Number: BYT-ORB2084662-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SHISA7
Conjugation: Biotin
Alternative Names: CKAMP59
SHISA7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 001138648
UniProt: A6NL88
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: INVPRALVDILRHQAGPGTRPDRARSSSLTPGIGGPDSMPPRTPKNLYNT