XKR8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084698
Article Name: XKR8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084698
Supplier Catalog Number: orb2084698
Alternative Catalog Number: BYT-ORB2084698-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human XKR8
Conjugation: Biotin
Alternative Names: XRG8, hXkr8
XKR8 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 060523
UniProt: Q9H6D3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG