VN1R4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084737
Article Name: VN1R4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084737
Supplier Catalog Number: orb2084737
Alternative Catalog Number: BYT-ORB2084737-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human VN1R4
Conjugation: Biotin
Alternative Names: V1RL4
VN1R4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 776256
UniProt: Q7Z5H5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LGLMLWVSSSMVCILHRHKQRVQHIDRSDLSPRASPENRATQSILILVST