USP41 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084752
Article Name: USP41 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084752
Supplier Catalog Number: orb2084752
Alternative Catalog Number: BYT-ORB2084752-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human USP41
Conjugation: Biotin
USP41 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 39kDa
UniProt: Q3LFD5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQ