TTC22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084806
Article Name: TTC22 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084806
Supplier Catalog Number: orb2084806
Alternative Catalog Number: BYT-ORB2084806-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TTC22
Conjugation: Biotin
TTC22 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 62kDa
UniProt: Q5TAA0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AARCLAEQGYAHGFDVGCASPEERARGLAAGIALYDKALGYGQQIPMEEK