TMPRSS11F Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2084830
Article Name: TMPRSS11F Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2084830
Supplier Catalog Number: orb2084830
Alternative Catalog Number: BYT-ORB2084830-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPRSS11F
Conjugation: Biotin
Alternative Names: HATL4
TMPRSS11F Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 997290
UniProt: Q6ZWK6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVF