SH3D21 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2085010
Article Name: SH3D21 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2085010
Supplier Catalog Number: orb2085010
Alternative Catalog Number: BYT-ORB2085010-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human SH3D21
Conjugation: Biotin
Alternative Names: C1orf113
SH3D21 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 078952
UniProt: A4FU49
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ERAFAQKTRPIKPPPDSQETLALPSLVPQNYTENKNEGVDVTSLRGEVES